CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Tomato Bruschetta

Toasted bread rubbed with garlic and topped with fresh tomatoes, basil, and olive oil. A classic Italian snack ready in 10 minutes.

Total time
10 min
Servings
4
Calories
185
Protein
5g
Tomato Bruschetta
freshsimpleitalianvegetariancrispyjuicyAppetizerparty

Ingredients

  • 1 loaf (8 oz) baguette or ciabatta
  • 1 lb (about 3 medium) ripe tomatoes
  • 2 clove garlic cloves
  • ¼ cup, loosely packed fresh basil
  • 3 tbsp olive oil

Instructions

  1. 1

    Slice baguette diagonally into 1/3-inch-thick pieces.

  2. 2

    Arrange bread slices on a baking sheet. Broil 3–4 minutes until golden and crispy on both sides, flipping halfway.

  3. 3

    Rub each hot slice with cut garlic clove until fragrant.

  4. 4

    Dice tomatoes and transfer to a bowl. Chop basil and add with 2 tbsp olive oil, salt, and pepper.

  5. 5

    Spoon tomato mixture onto each toast. Drizzle with remaining 1 tbsp olive oil.

  6. 6

    Serve immediately while bread is still warm.

Tools you’ll need

  • baking sheet
  • broiler or oven
  • serrated bread knife
  • cutting board
  • chef's knife
  • medium bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.