Tomato Bruschetta
Toasted bread rubbed with garlic and topped with fresh tomatoes, basil, and olive oil. A classic Italian snack ready in 10 minutes.
- Total time
- 10 min
- Servings
- 4
- Calories
- 185
- Protein
- 5g

freshsimpleitalianvegetariancrispyjuicypartyappetizer
Ingredients
- 1 loaf (8 oz) baguette or ciabatta
- 1 lb (about 3 medium) ripe tomatoes
- 2 clove garlic cloves
- ¼ cup, loosely packed fresh basil
- 3 tbsp olive oil
Instructions
- 1
Slice baguette diagonally into 1/3-inch-thick pieces.
- 2
Arrange bread slices on a baking sheet. Broil 3–4 minutes until golden and crispy on both sides, flipping halfway.
- 3
Rub each hot slice with cut garlic clove until fragrant.
- 4
Dice tomatoes and transfer to a bowl. Chop basil and add with 2 tbsp olive oil, salt, and pepper.
- 5
Spoon tomato mixture onto each toast. Drizzle with remaining 1 tbsp olive oil.
- 6
Serve immediately while bread is still warm.
Tools you’ll need
- baking sheet
- broiler or oven
- serrated bread knife
- cutting board
- chef's knife
- medium bowl
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



