Custrd is out on the App Store — Download it free →
Back to recipes

Tiradito: Seared Fish with Aji Amarillo

Silky raw fish kissed with heat, drowned in a bright yellow chili sauce and topped with crispy shallots. Peruvian elegance in under 15 minutes.

Total time
15 min
Servings
2
Calories
245
Protein
26g
Tiradito: Seared Fish with Aji Amarillo
elegantfreshperuvianfishsilkycrispydate-nightdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Arrange fish slices on a cold plate, slightly overlapping. Season with a pinch of salt.

  2. Step 2

    Heat oil in a small skillet over medium-high. Add shallots and cook until golden and crispy, ~3 minutes.

  3. Step 3

    Whisk aji amarillo paste with lime juice and 1 tbsp water until smooth and pourable.

  4. Step 4

    Pour sauce evenly over the fish. Scatter crispy shallots and cilantro on top.

  5. Step 5

    Drizzle with 1 tbsp of the hot oil from the shallot pan. Serve immediately.

Tools you’ll need

  • cold plate
  • small skillet
  • whisk
  • slicing knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.