Three-Ingredient Nutella Cookies
Impossibly simple cookies made with just Nutella, eggs, and flour. Chewy centers with crispy edges, ready in under 20 minutes.
- Total time
- 18 min
- Servings
- 12
- Calories
- 156
- Protein
- 3g
simpleindulgentvegetarianchewycrispyweeknightdessertcookie
Ingredients
- 1 cup Nutella
- 1 large eggs
- ¼ cup all-purpose flour
Instructions
- 1
Preheat oven to 350°F. Line a baking sheet with parchment paper.
- 2
Mix Nutella, egg, and flour in a bowl until a thick dough forms.
- 3
Scoop dough into 12 balls, spacing 2 inches apart on the sheet.
- 4
Bake 10–12 minutes until edges look set but centers still jiggle slightly.
- 5
Cool on the sheet 5 minutes, then transfer to a wire rack.
Tools you’ll need
- oven
- baking sheet
- parchment paper
- mixing bowl
- spoon or spatula
- wire rack
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
