CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Thai Stir-Fried Mixed Veg

A vibrant, 15-minute stir-fry of mixed vegetables tossed in a salty-sweet-spicy Thai sauce. One skillet, zero fuss — the kind of weeknight dinner that tastes way better than how easy it is.

Total time
15 min
Servings
2
Calories
165
Protein
5g
Thai Stir-Fried Mixed Veg
freshquickthaivegetarianvegancrispytenderweeknight

Ingredients

  • 4 cups mixed vegetables (broccoli florets, carrots sliced, snap peas, bell pepper)
  • 2 tbsp soy sauce
  • 1 tbsp fish sauce
  • 1 tbsp lime juice
  • 1 tsp granulated sugar
  • 1 tbsp Thai red curry paste (or sambal oelek)
  • 2 tbsp neutral cooking oil

Instructions

  1. 1

    Heat oil in a large skillet over medium-high heat for 90 seconds until it shimmers.

  2. 2

    Add mixed vegetables and stir-fry without stopping for 5–6 minutes until edges are lightly charred and tender-crisp.

  3. 3

    Whisk soy sauce, fish sauce, lime juice, sugar, and curry paste in a small bowl until paste dissolves.

  4. 4

    Pour sauce over vegetables and toss to coat evenly, stirring 1–2 minutes until glossy and fragrant.

  5. 5

    Serve immediately over rice or on its own, straight from the skillet.

Tools you’ll need

  • 12-inch skillet or wok
  • small bowl
  • whisk or fork

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.