CookSnap is coming soon — Join the waitlist →
Back to recipes

Thai Fish Cakes with Sweet Chili Sauce

Crispy, aromatic fish cakes loaded with Thai aromatics and served with tangy-sweet chili sauce. Pan-fried until golden, they're restaurant-quality yet achievable in under 30 minutes.

Total time
25 min
Servings
4
Calories
280
Protein
28g
Thai Fish Cakes with Sweet Chili Sauce
casualfreshthaifishcrispytenderweeknightappetizer

Ingredients

  • 1 lb white fish fillets (cod, halibut, or snapper)
  • 2 tbsp fish sauce
  • 2 tbsp Thai red curry paste
  • ½ cup cilantro and green onion, chopped
  • 2 tbsp lime juice
  • ½ cup panko breadcrumbs
  • 1 whole egg
  • ½ cup sweet chili sauce (store-bought)
  • 3 tbsp neutral oil

Instructions

  1. 1

    Cut fish into 1-inch chunks and place in a food processor with curry paste and fish sauce.

  2. 2

    Pulse until the mixture resembles coarse breadcrumbs but retains some texture.

  3. 3

    Transfer to a bowl and fold in panko, egg, cilantro, green onion, and lime juice.

  4. 4

    Form into 12 patties about 2 inches wide and 0.75 inches thick, pressing gently.

  5. 5

    Heat oil in a large skillet over medium-high until shimmering, about 1 minute.

  6. 6

    Working in two batches, pan-fry cakes 2–3 minutes per side until golden brown.

  7. 7

    Transfer cooked cakes to a paper towel–lined plate to drain briefly.

  8. 8

    Serve warm with sweet chili sauce for dipping on the side.

Tools you’ll need

  • food processor
  • large mixing bowl
  • 12-inch skillet
  • paper towels
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.