Custrd is out on the App Store — Download it free →
Back to recipes

Thai Chili Fish Curry

A quick and flavorful Thai-inspired fish curry with coconut milk, chili, and lime. Ready in about 20 minutes, perfect for a weeknight dinner.

Total time
20 min
Servings
4
Calories
320
Protein
25g
Thai Chili Fish Curry
comfortingquickThaigluten-freefishtendercreamyweeknight

Ingredients

  • 1 lb white fish fillets
  • 1 can (13.5 oz) coconut milk
  • 2 tbsp red curry paste
  • 1 lime
  • 2 cloves garlic
  • 1 tbsp fish sauce

Instructions

  1. 1

    Cut the 1 lb fish fillets into 2-inch chunks and season with a pinch of salt. Mince the 2 garlic cloves.

  2. 2

    In a large skillet over medium heat, add 1 tbsp oil and the minced garlic. Cook until fragrant, about 1 minute.

  3. 3

    Stir in the 2 tbsp red curry paste and cook for 1 minute until aromatic. Pour in the 1 can coconut milk and bring to a gentle simmer.

  4. 4

    Add the fish chunks and 1 tbsp fish sauce. Simmer gently until the fish is opaque and flakes easily, about 5-7 minutes.

  5. 5

    Remove from heat and squeeze the juice of 1 lime over the curry. Serve hot with rice if desired.

Tools you’ll need

  • Large skillet
  • Cutting board
  • Knife
  • Measuring spoons
  • Citrus juicer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.