Custrd is out on the App Store — Download it free →
Back to recipes

Thai Basil Chicken Rice with Omelet

A quick and flavorful weeknight stir-fry of minced chicken with Thai basil and garlic, served over steamed rice and topped with a simple omelet.

Total time
20 min
Servings
2
Calories
650
Protein
45g
Thai Basil Chicken Rice with Omelet
comfortingquickthaigluten-freechickentendercrispyweeknight

Ingredients

  • 1 lb minced chicken
  • 1 cup Thai basil leaves
  • 4 cloves garlic
  • 1 red chili
  • 2 eggs
  • 2 cups cooked rice

Instructions

  1. 1

    Mince 4 garlic cloves and 1 red chili. Heat 2 tbsp oil in a wok or large skillet over high heat until shimmering.

  2. 2

    Add the garlic and chili, stir-fry until fragrant, about 30 seconds. Add 1 lb minced chicken and spread it out; let it sear without stirring for 1 minute.

  3. 3

    Stir-fry the chicken until fully cooked and slightly crispy at edges, about 4-5 minutes. Season with 2 tbsp soy sauce, 1 tsp sugar, and a splash of water if dry.

  4. 4

    Turn off heat, stir in 1 cup Thai basil leaves until wilted. In a separate nonstick pan, cook 2 beaten eggs into a thin omelet over medium heat, about 2 minutes per side.

  5. 5

    Serve the chicken over 2 cups cooked rice, topped with the omelet. Add extra chili or fish sauce if you like.

Tools you’ll need

  • wok or large skillet
  • nonstick pan
  • knife and cutting board
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.