CookSnap is coming soon — Join the waitlist →

Thai Basil Chicken (Pad Krapow Gai)

The fierce, garlicky, holy-basil-scented stir-fry that Thai street vendors make in two minutes flat. Serve over jasmine rice with a crispy fried egg if you really want to do it right.

Total time
20 min
Servings
4
Calories
360
Protein
28g
Thai Basil Chicken (Pad Krapow Gai)
thaichickenstir-fryweeknightspicy

Ingredients

  • 1 lb ground chicken
  • 1 cup Thai basil leaves (or holy basil)
  • 5 garlic cloves
  • 3 Thai bird chilies (adjust to taste)
  • 2 tbsp oyster sauce
  • 1 tbsp fish sauce
  • 1 tbsp soy sauce
  • 1 tsp sugar
  • 2 tbsp neutral oil
  • 4 cup cooked jasmine rice, for serving

Instructions

  1. 1

    Smash the garlic and chilies together in a mortar and pestle until you have a rough paste. If you don't have a mortar, mince them very finely.

  2. 2

    Stir the oyster sauce, fish sauce, soy sauce, and sugar together in a small bowl with a tablespoon of water.

  3. 3

    Heat the oil in a wok or wide skillet over high heat until it's shimmering. Add the garlic-chili paste and stir for about 15 seconds, just until fragrant.

  4. 4

    Add the ground chicken, breaking it up with a spatula. Stir-fry until no pink remains, about 4 minutes.

  5. 5

    Pour in the sauce and toss to coat. Kill the heat, throw in the basil, and stir until the leaves just wilt. Serve immediately over rice.

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.