Tacos de Papa
Crispy pan-fried potatoes topped with fresh onion, cilantro, and lime—the classic Mexican street taco. Ready in 15 minutes.
- Total time
- 15 min
- Servings
- 2
- Calories
- 310
- Protein
- 5g
casualfreshmexicanvegetarianvegetariancrispytenderweeknight
Ingredients
- 1 lb potatoes, diced into 1/2-inch cubes
- 3 tbsp olive oil
- 1 to taste salt and pepper
- 8 count corn or flour tortillas
- ¼ large white onion, finely diced
- ¼ cup fresh cilantro, chopped
- 1 whole lime (for serving)
Instructions
- 1
Heat oil in a 12-inch skillet over medium-high until it shimmers, ~90 seconds.
- 2
Add diced potatoes. Cook without stirring for 4 minutes until bottoms turn golden.
- 3
Stir the potatoes, breaking up any sticking. Cook 5–6 more minutes until crispy.
- 4
Season generously with salt and pepper. Taste and adjust.
- 5
Warm tortillas in a dry skillet 15–20 seconds per side until pliable.
- 6
Divide potatoes among tortillas. Top with onion and cilantro.
- 7
Serve with lime wedges. Squeeze over the top just before eating.
Tools you’ll need
- 12-inch skillet
- cutting board
- chef's knife
- wooden spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
