CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Swiss Malakoff

A classic Swiss vegetarian cake layered with almond meringue wafers and kirsch-whipped cream. Elegant, make-ahead friendly, and impressively simple to assemble.

Total time
35 min
Servings
8
Calories
285
Protein
5g
Swiss Malakoff
elegantindulgentswissvegetarianvegetariancrispycreamyfluffy

Ingredients

  • 2 cups heavy cream, cold
  • 3 tablespoons powdered sugar
  • 2 tablespoons kirsch (or brandy)
  • 24 cookies almond wafer cookies (like Loacker brand)
  • ½ cup sliced almonds, toasted
  • 1 tablespoon cocoa powder (for dusting)

Instructions

  1. 1

    Pour the 2 cups cold heavy cream into a bowl and whisk with an electric mixer on high speed for 2–3 minutes until the cream holds soft peaks and looks thick and pillowy when you lift the whisk.

  2. 2

    Add the 3 tablespoons powdered sugar and the 2 tablespoons kirsch to the whipped cream, then whisk on low speed for 30 seconds until just combined and smooth.

  3. 3

    Place a single almond wafer on a flat plate or cake base and spread 1 tablespoon of the kirsch cream on top using a small spatula.

  4. 4

    Stack a second wafer on top of the cream, then spread another tablespoon of cream on that wafer.

  5. 5

    Repeat stacking and spreading with the remaining 22 wafers and cream, alternating wafer and cream layers, until all wafers are used and the cake is a tall vertical stack.

  6. 6

    Spread or gently press any remaining cream onto all four sides of the wafer stack to coat it evenly.

  7. 7

    Press the 0.5 cup toasted sliced almonds firmly onto all four sides of the cake so they stick to the cream.

  8. 8

    Use a fine-mesh sieve to dust the top of the cake evenly with the 1 tablespoon cocoa powder.

  9. 9

    Refrigerate the Malakoff for at least 30 minutes (or up to 8 hours) so the wafers soften slightly and the cream sets, making it easier to slice.

  10. 10

    Use a serrated knife dipped in hot water and wiped dry between cuts to slice the Malakoff into 8 equal portions, cutting straight down through the wafer stack.

Tools you’ll need

  • large mixing bowl
  • electric mixer (or whisk and arm strength)
  • small offset spatula or butter knife
  • flat plate or cake base
  • fine-mesh sieve
  • serrated knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.