CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Sweet Butter Msemen

Crispy pan-fried Moroccan layered pastry with melted butter and cinnamon sugar. Ready in 15 minutes — no phyllo or lamination needed, just a skillet and a simple dough.

Total time
15 min
Servings
2
Calories
520
Protein
6g
Sweet Butter Msemen
comfortcozymoroccanvegetarianvegetariancrispyflakymelty

Ingredients

  • 1.5 cups all-purpose flour
  • ½ cup butter, melted, divided
  • 3 tbsp granulated sugar
  • 1.5 tsp ground cinnamon
  • ¼ tsp salt
  • ½ cup warm water

Instructions

  1. 1

    Mix flour, salt, and 2 tbsp melted butter in a bowl with warm water until a rough dough forms.

  2. 2

    Knead dough on a floured surface for 2 minutes until smooth, then divide into 2 balls.

  3. 3

    Roll one ball into a thin 8-inch square, brush with melted butter, fold in half, brush again, fold in half again to make a small square.

  4. 4

    Heat 2 tbsp butter in a 10-inch skillet over medium until it foams, then slide one folded pastry square in.

  5. 5

    Cook 3 minutes until bottom is golden, flip once, cook 2 more minutes until second side is golden and crispy.

  6. 6

    Mix cinnamon and sugar on a plate, press warm msemen into the mixture to coat both sides, then repeat with second square. Serve warm.

Tools you’ll need

  • mixing bowl
  • 10-inch skillet
  • spatula
  • rolling pin

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.