Sweet and Spicy Chicken Wings
Crispy baked chicken wings tossed in a sticky sweet and spicy sauce, finished with sesame seeds. Ready in about 30 minutes with minimal effort.
- Total time
- 35 min
- Servings
- 4
- Calories
- 420
- Protein
- 28g
comfortingfestivekoreandairy-freechickencrispystickygame day
Ingredients
- 2 lb chicken wings
- 3 tbsp gochujang
- 2 tbsp honey
- 2 tbsp soy sauce
- 1 tbsp sesame oil
- 1 tbsp sesame seeds
Instructions
- 1
Preheat oven to 425°F. Pat 2 lb chicken wings dry with paper towels and place on a baking sheet lined with foil. Bake for 25-30 minutes until golden and crispy, flipping halfway.
- 2
In a small bowl, whisk together 3 tbsp gochujang, 2 tbsp honey, 2 tbsp soy sauce, and 1 tbsp sesame oil until smooth.
- 3
Transfer the cooked wings to a large bowl. Pour the sauce over and toss until every wing is coated.
- 4
Sprinkle with 1 tbsp sesame seeds and serve hot.
Tools you’ll need
- baking sheet
- aluminum foil
- small bowl
- large bowl
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
