CookSnap is coming soon — Join the waitlist →
Back to recipes

Sweet and Sour Shrimp

Tender shrimp tossed in a glossy sweet and sour sauce with bell peppers and pineapple. Ready in 20 minutes with minimal prep and just one pan.

Total time
20 min
Servings
2
Calories
318
Protein
35g
Sweet and Sour Shrimp
quicksatisfyingchineseshrimptenderjuicyweeknightstir-fry

Ingredients

  • 1 lb large shrimp, peeled and deveined
  • 1 whole bell pepper (red or yellow)
  • 1 cup pineapple chunks (fresh or canned in juice, drained)
  • 3 tablespoons rice vinegar
  • 2 tablespoons honey
  • 2 tablespoons soy sauce

Instructions

  1. 1

    Pat the shrimp dry with paper towels by pressing them gently between sheets, so they will brown properly instead of steaming.

  2. 2

    Slice the bell pepper lengthwise from the stem end to the tip into quarters, then remove the white core and seeds, then slice crosswise into bite-sized pieces roughly the width of your pinky finger.

  3. 3

    Stir together the rice vinegar, honey, and soy sauce in a small bowl until the honey dissolves and you see a uniform liquid.

  4. 4

    Heat 2 tablespoons of olive oil in a 12-inch skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  5. 5

    Add the shrimp in a single layer and cook for 2 minutes without stirring, so they develop a light golden sear on the bottom side.

  6. 6

    Flip each shrimp with tongs and cook for another 1 minute until the other side is light golden and the shrimp are firm to touch.

  7. 7

    Push the shrimp to one side of the skillet, then add the bell pepper pieces to the empty side and cook for 2 minutes, stirring once halfway through.

  8. 8

    Pour the sauce mixture into the center of the skillet and stir gently for 1 minute until everything is coated and the liquid turns glossy.

  9. 9

    Add the pineapple chunks and stir gently for 30 seconds until they are warmed through and coated with sauce.

  10. 10

    Taste a shrimp and a piece of pepper; add salt and pepper as needed until the flavor is balanced between sweet, tangy, and savory.

Tools you’ll need

  • 12-inch skillet with lid
  • paper towels
  • cutting board
  • chef's knife
  • small mixing bowl
  • wooden spoon or spatula
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.