CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Swedish Beef Wallenbergare with Roasted Veg

Tender ground beef patties with creamy dill sauce, plated with roasted potatoes, fresh cucumbers, tomatoes, and peppers. A Scandinavian weeknight dinner that feels fancy but takes under 30 minutes.

Total time
28 min
Servings
2
Calories
468
Protein
28g
Swedish Beef Wallenbergare with Roasted Veg
elegantcomfortscandinavianbeeftendercreamyweeknightdinner

Ingredients

  • ½ lb ground beef
  • ¼ cup panko breadcrumbs
  • 1 whole egg
  • ½ cup beef broth
  • ¼ cup sour cream or crème fraîche
  • 2 tbsp fresh dill (chopped)
  • 1 lb potatoes, pre-roasted or fresh
  • 2 cups cucumber, bell peppers, cherry tomatoes (fresh)

Instructions

  1. 1

    Mix ground beef with panko, egg, salt, and pepper until just combined; form into two thick oval patties.

  2. 2

    Heat butter and oil in a skillet over medium-high; sear patties 4 minutes per side until golden brown.

  3. 3

    Pour beef broth into the skillet around the patties; simmer uncovered 3 minutes until liquid reduces slightly.

  4. 4

    Stir sour cream and fresh dill into the pan; reduce heat to low and warm through 1 minute without boiling.

  5. 5

    While sauce simmers, warm or char potatoes and arrange fresh cucumbers, peppers, and tomatoes on a platter.

  6. 6

    Plate patties with dill cream sauce and arrange roasted potatoes and fresh vegetables alongside.

Tools you’ll need

  • 12-inch skillet or sauté pan
  • mixing bowl
  • spatula
  • wooden spoon
  • platter or dinner plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.