CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Strozzapreti al Pomodoro & Mozzarella

Twisted pasta in a bright tomato sauce with fresh mozzarella and basil—ready in under 25 minutes. No cream, no fuss, just silky Italian comfort.

Total time
25 min
Servings
4
Calories
520
Protein
20g
Strozzapreti al Pomodoro & Mozzarella
comfortsimpleitalianvegetarianvegetariantendersilkyweeknight

Ingredients

  • 1 lb strozzapreti pasta
  • 28 oz canned whole tomatoes
  • 8 oz fresh mozzarella, torn into bite-sized pieces
  • ½ cup fresh basil leaves
  • 3 cloves garlic cloves, sliced thin
  • ¼ tsp red pepper flakes
  • 3 tbsp extra-virgin olive oil

Instructions

  1. 1

    Boil salted water in a large pot over high heat. Add strozzapreti and cook until al dente, ~9 minutes.

  2. 2

    While pasta cooks, heat olive oil in a large skillet over medium. Add sliced garlic and red pepper flakes, stirring until fragrant, ~60 seconds.

  3. 3

    Pour in canned tomatoes, crushing by hand. Simmer, stirring occasionally, until sauce thickens slightly, ~6 minutes.

  4. 4

    Drain pasta, reserving 1 cup pasta water. Add pasta to the skillet and toss gently.

  5. 5

    Remove from heat. Scatter torn mozzarella and basil over the top, stirring gently to melt.

  6. 6

    If sauce is too thick, add pasta water 2 tablespoons at a time. Season with salt and pepper, then serve immediately.

Tools you’ll need

  • large pot
  • large skillet
  • wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.