Strawberry Spinach Salad
Fresh spinach tossed with sweet strawberries, candied almonds, and a bright poppy seed dressing. Ready in 15 minutes.
- Total time
- 15 min
- Servings
- 4
- Calories
- 315
- Protein
- 8g

freshlightvegetariancrispytenderweeknightbrunchlight-lunch
Ingredients
- 5 cups fresh spinach
- 8 oz strawberries, hulled
- ½ cup sliced almonds
- 2 tbsp honey
- 1 tbsp poppy seeds
- 3 tbsp red wine vinegar
- 6 tbsp olive oil
- to taste salt and pepper
Instructions
- 1
Toast almonds in a dry skillet over medium heat, shaking occasionally, until fragrant, 4–5 minutes.
- 2
Drizzle honey over warm almonds, toss to coat, then spread on a plate to cool.
- 3
Whisk together vinegar, poppy seeds, and olive oil in a small bowl until smooth.
- 4
Slice strawberries into halves or thirds, depending on size.
- 5
Place spinach in a large bowl, pour dressing over, and toss until evenly coated.
- 6
Top with strawberries and candied almonds. Season with salt and pepper, then serve.
Tools you’ll need
- 10-inch skillet
- small whisk
- large mixing bowl
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



