CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Steamed Grouper with Ginger Scallion

Tender, flaky grouper fillets steamed in minutes with a fragrant ginger-scallion oil that hits like a restaurant dish. Pure umami, zero fuss.

Total time
15 min
Servings
2
Calories
285
Protein
36g
Steamed Grouper with Ginger Scallion
lightsimplechinesefishtenderflakyweeknightmain-dish

Ingredients

  • 1 lb grouper fillets
  • 2 tbsp minced fresh ginger
  • 4 whole scallions, divided
  • 3 tbsp soy sauce
  • 3 tbsp neutral oil
  • 1 tsp sesame oil

Instructions

  1. 1

    Set up a steamer: fill a pot with 1 inch water, place a steamer basket or bamboo steamer on top, and bring water to a rolling boil.

  2. 2

    Pat grouper fillets dry with paper towels. Arrange on a heatproof plate, season lightly with salt and pepper.

  3. 3

    Slice 2 scallions into thin rings; set aside for garnish. Chop the remaining 2 scallions into 1-inch pieces.

  4. 4

    Slide the plate of grouper into the steamer. Cover and steam for 6–8 minutes until fish flakes easily at the thickest part.

  5. 5

    Heat neutral oil in a small skillet over medium-high for 90 seconds until it shimmers. Add ginger and chopped scallions, stir for 30 seconds until fragrant.

  6. 6

    Remove from heat. Stir in soy sauce and sesame oil. Pour the ginger-scallion oil over the steamed grouper and garnish with sliced scallions. Serve immediately.

Tools you’ll need

  • steamer basket or bamboo steamer
  • medium pot
  • heatproof plate
  • paper towels
  • small skillet
  • spoon for stirring

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.