CookSnap is in beta — Get it free on TestFlight →
Back to recipes

15-Minute Spinach & Feta Fatayer

Crispy, flaky pastry triangles bursting with garlicky spinach, salty feta, and a bright squeeze of lemon. No dough-making required—store-bought phyllo turns this Lebanese classic into a weeknight snack.

Total time
15 min
Servings
2
Calories
285
Protein
9g
15-Minute Spinach & Feta Fatayer
quicksatisfyinglebanesevegetarianvegetariancrispyflakysnack

Ingredients

  • 10 oz frozen spinach, thawed and squeezed dry
  • ¾ cup crumbled feta cheese
  • 2 cloves garlic, minced
  • 6 sheets phyllo dough sheets
  • ½ whole lemon, halved
  • 3 tbsp olive oil

Instructions

  1. 1

    Stir spinach, feta, minced garlic, salt, and pepper in a small bowl until combined.

  2. 2

    Lay one phyllo sheet flat. Brush lightly with olive oil and fold in half lengthwise.

  3. 3

    Spoon 2 tbsp filling near the top corner, then fold into a triangle by folding corner over corner down the length of the strip.

  4. 4

    Repeat with remaining phyllo and filling, creating 6 triangles total.

  5. 5

    Heat 3 tbsp olive oil in a 10-inch nonstick skillet over medium-high until it shimmers, about 1 minute.

  6. 6

    Fry triangles 2–3 minutes per side until golden brown and crispy. Squeeze lemon over warm fatayer and serve immediately.

Tools you’ll need

  • small mixing bowl
  • 10-inch nonstick skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.