CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Spinach & Cheese Gozleme

Turkish hand-stretched flatbread folded around a garlicky spinach-and-cheese filling, pan-fried until golden and crispy. A weeknight dinner that tastes like a Turkish street stall.

Total time
25 min
Servings
2
Calories
420
Protein
13g
Crispy Spinach & Cheese Gozleme
casualsatisfyingturkishvegetariancheesecrispytendermelty

Ingredients

  • 1.5 cups all-purpose flour
  • ¾ cup water, warm
  • 2 cups fresh spinach, packed
  • ¾ cup feta cheese, crumbled
  • 2 cloves garlic, minced
  • ½ lemon lemon, juiced
  • ¼ tsp red pepper flakes

Instructions

  1. 1

    Mix flour, warm water, and a pinch of salt in a bowl until shaggy. Knead for 2 minutes until soft and slightly sticky.

  2. 2

    Heat 1 tbsp oil in a large skillet over medium. Add garlic and cook 30 seconds until fragrant.

  3. 3

    Add spinach in batches, stirring until wilted, ~2 minutes. Remove from heat and stir in feta, lemon juice, and red pepper flakes.

  4. 4

    Divide dough in half. On a flour-dusted surface, stretch one half into a thin 8-inch round, rotating as you go.

  5. 5

    Spread half the spinach-feta filling on one half of the round, fold dough over to seal, and press edges gently.

  6. 6

    Wipe skillet clean, heat 1 tbsp oil over medium-high until shimmering. Slide gozleme in and cook 2–3 minutes per side until golden and crispy. Repeat with remaining dough and filling.

Tools you’ll need

  • large mixing bowl
  • 12-inch non-stick or cast iron skillet
  • wooden spoon
  • rolling surface (counter or cutting board)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.