CookSnap is coming soon — Join the waitlist →
Back to recipes

Spicy Shrimp Tempura Rolls

Crispy shrimp tempura wrapped in sushi rice and nori, finished with a spicy mayo drizzle. A 25-minute shortcut that tastes like the sushi bar without the price tag.

Total time
25 min
Servings
2
Calories
520
Protein
18g
Spicy Shrimp Tempura Rolls
indulgentcasualjapaneseshrimpcrispytenderweeknightdate-night

Ingredients

  • 8 count large shrimp, peeled and deveined
  • ½ cup all-purpose flour
  • ½ cup panko breadcrumbs
  • 1.5 cups sushi rice, cooked and cooled
  • 2 count nori sheets
  • ¼ cup mayonnaise mixed with sriracha
  • 2 tbsp sesame seeds

Instructions

  1. 1

    Heat 1 inch of neutral oil in a heavy pot to 350°F. Pat shrimp dry with paper towels.

  2. 2

    Set up a dredging station: flour in one bowl, beaten egg in another, panko in a third.

  3. 3

    Coat each shrimp in flour, shake off excess, dip in egg, then coat fully in panko.

  4. 4

    Fry shrimp 90 seconds per side until golden. Drain on paper towels.

  5. 5

    Spread rice on nori, lay 4 tempura shrimp across the middle, roll tightly into a log.

  6. 6

    Slice each roll into 6 pieces with a wet knife. Drizzle with spicy mayo, sprinkle sesame seeds, serve with soy sauce.

Tools you’ll need

  • heavy pot or deep skillet
  • instant-read thermometer
  • paper towels
  • three shallow bowls
  • slotted spoon
  • sharp knife
  • bamboo sushi mat (optional but helpful)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.