CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Spicy Bibim Kalguksu

Hand-torn noodles in a gochujang-spiked broth, tossed with crispy fried vegetables and a runny egg. One bowl, 25 minutes, pure comfort.

Total time
25 min
Servings
2
Calories
480
Protein
16g
Spicy Bibim Kalguksu
comfortcozykoreanvegetarianeggschewycrispysilky

Ingredients

  • 1 cup all-purpose flour
  • 2 tbsp gochujang (Korean red chili paste)
  • 1 medium zucchini
  • 1 medium carrot
  • 4 oz shiitake mushrooms
  • 2 tbsp sesame oil
  • 2 whole eggs
  • 4 cups vegetable broth

Instructions

  1. 1

    Mix flour with 0.5 cup water and a pinch of salt until shaggy. Knead 2 minutes until smooth, then let rest 5 minutes.

  2. 2

    Slice zucchini, carrot, and mushrooms into thin matchsticks. Heat 1 tbsp sesame oil in a skillet over medium-high.

  3. 3

    Fry vegetables in batches until edges curl and brown slightly, ~3 minutes total. Transfer to a plate, sprinkle with salt.

  4. 4

    Bring broth to a boil in a large pot. Tear dough into bite-sized pieces and drop them in, stirring gently until they float.

  5. 5

    Stir in gochujang until dissolved. Slide 2 eggs into the simmering broth and cook until whites set, ~2 minutes.

  6. 6

    Divide noodles and broth between bowls, top with fried vegetables, drizzle remaining sesame oil, and serve immediately.

Tools you’ll need

  • large mixing bowl
  • 12-inch skillet
  • large pot (4-quart or bigger)
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.