Custrd is out on the App Store — Download it free →
Back to recipes

Spicy Batata Harra with Lemon & Lettuce

Crispy fried potatoes tossed with garlic, cilantro, and chili for a vibrant Middle Eastern side that's loud enough to be dinner. Served with cool lettuce and bright lemon to cut through the heat.

Total time
25 min
Servings
2
Calories
320
Protein
5g
Spicy Batata Harra with Lemon & Lettuce
comfortboldmiddle-easternvegetarianvegandairy-freecrispytender

Ingredients

  • 1.5 lb waxy potatoes (fingerling or small red)
  • 3 tbsp neutral cooking oil
  • 6 cloves, minced garlic
  • ½ tsp red chili flakes (or fresh hot chili, minced)
  • ½ cup fresh cilantro (and/or parsley), chopped
  • 1 whole lemon
  • 4 leaves romaine or butter lettuce leaves

Instructions

  1. 1

    Cut potatoes into 1-inch chunks. Heat oil in a large skillet over medium-high until it shimmers, about 60 seconds.

  2. 2

    Add potatoes and cook without stirring for 4 minutes until the bottom edges turn golden, then toss and cook 6–8 minutes more until crispy and cooked through.

  3. 3

    Push potatoes to the side, add minced garlic and chili flakes to the empty space, and cook 30 seconds until fragrant.

  4. 4

    Toss everything together, then fold in cilantro and a big pinch of salt off heat.

  5. 5

    Squeeze half the lemon over the potatoes. Serve with lettuce leaves on the side and remaining lemon wedges.

Tools you’ll need

  • large skillet (12-inch cast iron or non-stick preferred)
  • knife and cutting board
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.