CookSnap is coming soon — Join the waitlist →
Back to recipes

Spiced Lentil & Potato Fatira

A crispy, stuffed Ethiopian pastry filled with savory lentils and potatoes, spiked with berbere spice and cooked in a skillet until golden. Ready in under 30 minutes with store-bought pastry.

Total time
28 min
Servings
4
Calories
485
Protein
14g
Spiced Lentil & Potato Fatira
comfortrusticethiopianvegetarianveganlentilscrispyflaky

Ingredients

  • 1 package (2 sheets) puff pastry sheets (thawed)
  • 1 cup red lentils, cooked
  • 2 medium potatoes, diced small
  • 1.5 tsp berbere spice blend
  • ½ medium yellow onion, diced
  • 1 tbsp ginger, minced
  • ½ cup vegetable broth or water

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium. Add onion and ginger; cook 2 minutes until fragrant.

  2. 2

    Stir in potatoes, cooked lentils, berbere, salt, and broth. Simmer 8 minutes until potatoes soften, stirring occasionally.

  3. 3

    Spread filling on one half of each pastry sheet, leaving a 0.5-inch border. Fold pastry in half; press edges to seal.

  4. 4

    Wipe skillet clean. Heat 3 tbsp oil over medium-high until shimmering.

  5. 5

    Slide fatiras into skillet. Pan-fry 4 minutes per side until deep golden brown and crispy.

  6. 6

    Transfer to a plate. Cool 1 minute, then cut in half. Serve hot with lemon wedges if desired.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.