CookSnap is coming soon — Join the waitlist →

25-Min Spanish Potato Omelette with Crispy Empanadas

Golden, custardy potato tortilla finished under the broiler, served with store-bought crispy empanadas and garlicky aioli. This is the TikTok weeknight version — no flipping, no fuss.

Total time
25 min
Servings
2
Calories
620
Protein
18g
25-Min Spanish Potato Omelette with Crispy Empanadas
comfortsimplespanishvegetarianeggscreamycrispyweeknight

Ingredients

  • 1.25 lb waxy potatoes (Yukon Gold or fingerling)
  • 1 medium yellow onion
  • 8 large eggs
  • ⅓ cup olive oil
  • 4 count store-bought empanadas (frozen or fresh)
  • ½ cup aioli (store-bought or jarred mayo + 1 clove garlic)
  • 1 to taste salt and black pepper

Instructions

  1. 1

    Slice potatoes into 1/8-inch rounds. Dice the onion into small pieces.

  2. 2

    Heat 0.25 cup olive oil in a 10-inch non-stick skillet over medium. Add potatoes and onion, stirring gently, until potatoes are tender but not brown, ~12 minutes.

  3. 3

    While potatoes cook, beat eggs in a bowl with a pinch of salt and pepper. Brush empanadas lightly with remaining oil and arrange on a small sheet pan.

  4. 4

    Pour eggs over potatoes in the skillet, tilting to distribute evenly. Cook on the stove over medium until edges set but center still jiggles, ~3 minutes.

  5. 5

    Transfer skillet to the broiler (or place sheet pan of empanadas under broiler). Cook until tortilla is set and golden, ~2 minutes.

  6. 6

    Slide tortilla onto a cutting board. Serve warm wedges with crispy empanadas and aioli on the side.

Tools you’ll need

  • 10-inch non-stick skillet
  • small sheet pan
  • mixing bowl
  • broiler or oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.