CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Southern Pan-Fried Liver and Onions

Tender beef liver paired with caramelized onions in a classic Southern skillet dinner. Ready in under 30 minutes with minimal ingredients and maximum comfort-food flavor.

Total time
25 min
Servings
2
Calories
425
Protein
38g
Southern Pan-Fried Liver and Onions
comfortheartysouthernbeeftendercrispyweeknightmain-dish

Ingredients

  • 1 lb beef liver, sliced
  • 2 medium yellow onions
  • ¼ cup all-purpose flour
  • 1 tsp salt
  • ½ tsp black pepper
  • 3 tbsp vegetable oil

Instructions

  1. 1

    Pat the liver slices dry with paper towels—this helps them brown instead of steam when they hit the hot pan.

  2. 2

    Peel the onions, then cut each one in half from root to tip, then turn the flat side down and slice crosswise into 1/4-inch-wide rings.

  3. 3

    Pour the flour into a shallow bowl or plate, then add the salt and pepper and stir with a fork until mixed evenly.

  4. 4

    Set a 12-inch skillet over medium-high heat and pour in 2 tablespoons of oil, then wait until it shimmers and slides quickly when you tilt the pan.

  5. 5

    Working with 3–4 liver slices at a time, lay each slice in the flour mixture, press gently so both sides get a light coating, then tap off excess flour.

  6. 6

    Lay the coated liver slices in the hot oil in a single layer—they should sizzle immediately—and cook without moving them for 2 minutes until the underside is golden-brown.

  7. 7

    Flip each liver slice over and cook the other side for 90 seconds until the outside is browned but the center still feels slightly soft when pressed with a finger.

  8. 8

    Transfer the cooked liver slices to a clean plate, then repeat steps 5–7 with the remaining liver slices using the same hot oil.

  9. 9

    Add the remaining 1 tablespoon of oil to the same skillet, then tip in all the onion slices and stir with a wooden spoon to coat them.

  10. 10

    Cook the onions over medium heat, stirring once every 2 minutes, for 12–15 minutes until they turn dark golden brown and feel completely soft when poked with a fork.

  11. 11

    Nestle all the cooked liver slices back into the skillet on top of the caramelized onions, then toss gently to combine and warm the liver through, about 1 minute.

Tools you’ll need

  • paper towels
  • cutting board
  • knife
  • shallow bowl or plate
  • fork
  • 12-inch skillet
  • wooden spoon
  • tongs or spatula
  • clean plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.