CookSnap is coming soon — Join the waitlist →
Back to recipes

Sour Cherry Strudel with Pistachios

Crispy phyllo wrapped around tart sour cherries, baked until golden and topped with crushed pistachios. A 25-minute Hungarian dessert that tastes like it took hours.

Total time
25 min
Servings
4
Calories
285
Protein
4g
Sour Cherry Strudel with Pistachios
elegantindulgenthungarianvegetariancrispyflakydessertweekend

Ingredients

  • 1.5 cups sour cherry preserves or canned sour cherries, drained
  • 6 sheets phyllo dough sheets
  • 4 tbsp butter, melted
  • 2 tbsp granulated sugar
  • 1 tbsp cornstarch
  • ¼ tsp ground cinnamon
  • ½ cup crushed pistachios

Instructions

  1. 1

    Preheat oven to 375°F. Mix sour cherries with cornstarch, sugar, and cinnamon in a bowl.

  2. 2

    Lay one phyllo sheet on a work surface. Brush lightly with melted butter. Repeat with 3 more sheets, stacking.

  3. 3

    Spread cherry mixture along the long edge closest to you, leaving 2 inches on the sides.

  4. 4

    Roll tightly away from you, tucking sides in as you go. Place seam-side down on a greased baking sheet.

  5. 5

    Brush top with remaining melted butter. Bake until golden and crispy, 15–18 minutes.

  6. 6

    Cool 5 minutes, then slice and top generously with crushed pistachios. Serve warm.

Tools you’ll need

  • 9x13-inch baking sheet
  • large mixing bowl
  • pastry brush
  • sharp knife
  • work surface or cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.