CookSnap is coming soon — Join the waitlist →

Soupe à l'Oignon

A classic French caramelized onion soup with toasted bread and melted Gruyère. Rich, warming, and surprisingly simple—the slow cook transforms humble onions into liquid gold.

Total time
50 min
Servings
4
Calories
380
Protein
14g
Soupe à l'Oignon
comfortelegantfrenchvegetariancreamymeltyweeknightcozy

Ingredients

  • 4 medium yellow onions, thinly sliced
  • 2 tbsp unsalted butter
  • 1 tbsp olive oil
  • 4 cups vegetable broth
  • ½ cup dry white wine
  • 8 slices baguette, sliced into 0.5-inch rounds
  • 1 cup Gruyère cheese, grated
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Melt butter with oil in a large pot over medium heat, about 1 minute.

  2. 2

    Add sliced onions and stir to coat. Cook uncovered for 30–35 minutes, stirring occasionally.

  3. 3

    Onions should be deep golden brown and very soft. Scrape any browned bits from the bottom.

  4. 4

    Pour wine into the pot and stir, scraping up caramelized bits. Cook 2 minutes.

  5. 5

    Add broth and bring to a gentle simmer. Cook for 10 minutes uncovered.

  6. 6

    Taste and season generously with salt and pepper.

  7. 7

    Preheat broiler to high. Arrange baguette slices on a baking sheet in a single layer.

  8. 8

    Broil bread 2–3 minutes per side until golden brown and crispy.

  9. 9

    Ladle soup into broiler-safe bowls or crocks. Top each with a piece of toasted bread.

  10. 10

    Cover bread generously with Gruyère. Broil 3–4 minutes until cheese bubbles and browns.

  11. 11

    Cool 1–2 minutes. Serve immediately.

Tools you’ll need

  • large heavy-bottomed pot (5-quart minimum)
  • baking sheet
  • broiler-safe bowls or crocks
  • wooden spoon
  • ladle
  • box grater

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.