CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Smoked Beef Cheeks — 20-Minute Pan

Pre-smoked beef cheeks seared until caramelized and tender, finished with a quick pan glaze. Showstopping restaurant-quality plate in under 20 minutes.

Total time
18 min
Servings
2
Calories
445
Protein
52g
Smoked Beef Cheeks — 20-Minute Pan
elegantsatisfyingamericanbeeftendercrispyweeknightdate-night

Ingredients

  • 1.2 lbs smoked beef cheeks, pre-cooked
  • ½ cup beef or chicken stock
  • 2 tbsp butter
  • 1 tbsp balsamic vinegar
  • 2 cloves garlic cloves, minced
  • 3 sprigs fresh thyme sprigs

Instructions

  1. 1

    Pat beef cheeks dry with paper towels. Season generously with salt and black pepper on both sides.

  2. 2

    Heat 1 tbsp butter in a 12-inch skillet over medium-high until it foams, about 1 minute.

  3. 3

    Sear beef cheeks 2 minutes per side without moving — surface should be deep brown and crispy.

  4. 4

    Remove cheeks to a plate. Add garlic and thyme to the pan, cook 30 seconds until fragrant.

  5. 5

    Pour in stock and balsamic, scraping browned bits. Return cheeks to pan, simmer 3 minutes.

  6. 6

    Swirl in remaining 1 tbsp butter until glaze looks glossy. Plate cheeks and drizzle pan sauce over top.

Tools you’ll need

  • 12-inch stainless steel or cast iron skillet
  • paper towels
  • tongs
  • plate
  • spoon or wooden spoon for scraping

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.