CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Sizzling Veggie Fajitas

Charred bell peppers, onions, and zucchini with chili powder and lime, wrapped in warm tortillas. Comes together in one skillet in 20 minutes.

Total time
20 min
Servings
2
Calories
285
Protein
7g
Sizzling Veggie Fajitas
casualsatisfyingtex-mexvegetarianvegetariancrispytenderweeknight

Ingredients

  • 2 medium bell peppers (1 red, 1 yellow), sliced into 1/4-inch strips
  • 1 medium yellow onion, sliced into 1/4-inch strips
  • 1 medium zucchini, sliced into 1/4-inch half-moons
  • 3 tbsp olive oil
  • 1.5 tsp chili powder
  • 4 count flour tortillas (6-inch)
  • 1 count lime (halved)

Instructions

  1. 1

    Heat oil in a 12-inch skillet over medium-high until it shimmers, about 90 seconds.

  2. 2

    Add peppers, onion, and zucchini. Sprinkle chili powder, salt, and pepper over top.

  3. 3

    Sauté without stirring for 2 minutes until edges char, then stir and cook 3 more minutes until tender-crisp and lightly blackened.

  4. 4

    Warm tortillas directly over a gas flame (or in the skillet edges) for 15 seconds per side until pliable.

  5. 5

    Divide veggies among tortillas. Squeeze lime juice over each and serve immediately.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.