CookSnap is coming soon — Join the waitlist →
Back to recipes

Shrimp Wonton Soup

Silky broth meets tender shrimp-filled wontons in this classic Chinese soup. Ready in under 40 minutes with a mix of fresh ginger, garlic, and a touch of sesame.

Total time
38 min
Servings
4
Calories
184
Protein
16g
Shrimp Wonton Soup
comfortwholesomechineseshrimptendersilkyweeknightsoup

Ingredients

  • ½ lb shrimp, peeled and deveined
  • 20 pieces wonton wrappers
  • 6 cups chicken or vegetable broth
  • 2 tbsp ginger, peeled and sliced thin
  • 3 cloves garlic cloves, minced
  • 2 tbsp soy sauce
  • 1 tsp sesame oil
  • 2 stalks green onions, sliced
  • 1 pinch salt and white pepper to taste

Instructions

  1. 1

    Chop shrimp into small pieces, about 1/4-inch chunks. Set aside.

  2. 2

    Place shrimp, 1 tsp soy sauce, and a pinch of salt in a bowl. Stir to coat.

  3. 3

    Fill a small bowl with water. Place a wonton wrapper flat on your work surface.

  4. 4

    Spoon 1 tsp shrimp mixture into the center of the wrapper. Dip your finger in water and trace the edges.

  5. 5

    Fold the wrapper in half diagonally to form a triangle, pressing edges to seal.

  6. 6

    Bring the two corner points of the triangle together and press to seal into a wonton shape. Repeat with remaining wrappers.

  7. 7

    Bring broth to a boil in a large pot over high heat, about 5 minutes.

  8. 8

    Add ginger slices and minced garlic. Simmer for 2 minutes until fragrant.

  9. 9

    Add wontons one at a time, stirring gently to prevent sticking. Simmer until they float, about 4 minutes.

  10. 10

    Stir in remaining 1 tbsp soy sauce and sesame oil.

  11. 11

    Taste and adjust with salt and white pepper.

  12. 12

    Ladle soup into bowls and garnish with green onion slices. Serve hot.

Tools you’ll need

  • large pot (3-quart minimum)
  • cutting board
  • chef's knife
  • small bowl
  • ladle
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.