CookSnap is coming soon — Join the waitlist →
Back to recipes

Shrimp Tempura Udon

Crispy tempura shrimp served over silky udon noodles in a savory dashi broth. A restaurant-quality Japanese comfort bowl ready in under an hour.

Total time
45 min
Servings
2
Calories
580
Protein
18g
Shrimp Tempura Udon
comfortsatisfyingjapaneseshrimpcrispytendersilkyweeknight

Ingredients

  • 12 count shrimp, large (16–20 count), peeled and deveined
  • ¾ cup all-purpose flour
  • ½ cup cornstarch
  • ¾ cup ice-cold water
  • 8 oz udon noodles, fresh or frozen
  • 3 cup dashi broth or instant dashi
  • 2 tbsp mirin
  • 1 tbsp soy sauce
  • 4 cup vegetable oil for deep frying
  • 2 stalk scallions, sliced thin, for garnish

Instructions

  1. 1

    Pat shrimp dry with paper towels. Season lightly with salt and pepper.

  2. 2

    Combine flour and cornstarch in a bowl. Keep ice water separate.

  3. 3

    Prepare dashi broth according to package directions; stir in mirin and soy sauce.

  4. 4

    Heat oil in a heavy pot to 350°F. Use a thermometer to check — oil will shimmer.

  5. 5

    Just before frying, whisk ice water into flour mixture until batter looks lumpy.

  6. 6

    Dip shrimp into batter; gently place in hot oil. Fry 4–5 shrimp at a time.

  7. 7

    Fry shrimp 2–3 minutes per batch until light golden and crispy. Transfer to paper towels.

  8. 8

    Boil udon noodles in salted water until tender, ~3 minutes. Drain well.

  9. 9

    Divide noodles into bowls. Pour hot broth over noodles, filling three-quarters full.

  10. 10

    Arrange fried shrimp on top of noodles. Garnish with scallions.

  11. 11

    Serve immediately while tempura is still crispy.

Tools you’ll need

  • heavy-bottomed pot or Dutch oven
  • instant-read thermometer
  • paper towels
  • two mixing bowls
  • whisk
  • slotted spoon
  • kitchen tongs
  • large pot for boiling noodles
  • soup ladle
  • two bowls for serving

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.