CookSnap is coming soon — Join the waitlist →
Back to recipes

Shrimp Tempura Bowl with Daikon & Green Tea

Crispy shrimp tempura over rice with grated daikon, served with a light dipping sauce and green tea. Ready in under 25 minutes with minimal cleanup.

Total time
25 min
Servings
2
Calories
580
Protein
22g
Shrimp Tempura Bowl with Daikon & Green Tea
satisfyingcasualjapaneseshrimpcrispytenderweeknightdinner

Ingredients

  • ¾ lb large shrimp, peeled and deveined
  • ½ cup all-purpose flour
  • ½ cup ice-cold club soda or water
  • 3 cups neutral oil for frying
  • 2 cups cooked sushi rice or short-grain rice
  • 1 cup daikon radish, finely grated
  • 3 tbsp soy sauce
  • 2 tbsp mirin (or honey as substitute)

Instructions

  1. 1

    Pat shrimp dry with paper towels. Season lightly with salt and pepper.

  2. 2

    Heat oil in a heavy-bottomed pot or skillet to 350°F (use a thermometer). Mix flour and club soda into a thin, lumpy batter.

  3. 3

    Working in batches, dip shrimp in batter and slide into hot oil. Fry 2-3 minutes per batch until golden and crispy.

  4. 4

    Remove shrimp to a paper towel-lined plate. Whisk soy sauce and mirin in a small bowl for dipping.

  5. 5

    Divide warm rice between two bowls. Top each with tempura shrimp and a mound of grated daikon.

  6. 6

    Drizzle dipping sauce over the bowl or serve on the side. Serve hot with a cup of warm green tea.

Tools you’ll need

  • heavy-bottomed pot or 12-inch skillet
  • deep-fry thermometer
  • paper towels
  • small mixing bowl
  • slotted spoon
  • two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.