CookSnap is coming soon — Join the waitlist →
Back to recipes

Shrimp Tempura

Crispy, delicate Japanese fried shrimp with a light, airy batter. Serve hot with dipping sauce for an elegant appetizer or light meal.

Total time
20 min
Servings
2
Calories
320
Protein
16g
Shrimp Tempura
elegantlightjapaneseshrimpcrispyairytenderweeknight

Ingredients

  • 12 count large shrimp, peeled and deveined
  • ½ cup all-purpose flour
  • ½ cup cornstarch
  • ¾ cup cold water
  • ½ teaspoon salt
  • 3 cups neutral oil for frying (vegetable or canola)

Instructions

  1. 1

    Pat the shrimp dry with paper towels by pressing each shrimp between two folded towels until no moisture beads on the surface. This helps the batter stick.

  2. 2

    Pour the flour, cornstarch, and salt into a large mixing bowl. Whisk them together until evenly combined and no white streaks of flour remain.

  3. 3

    Pour the cold water into the flour mixture and whisk until the batter looks like thin pancake batter — no lumps visible and the consistency pours easily.

  4. 4

    Fill a heavy pot or deep skillet with 3 inches of oil and heat over medium-high heat until the oil shimmers and a wooden chopstick inserted in it releases tiny bubbles immediately, about 5 minutes.

  5. 5

    Grip one shrimp by its tail, dip it into the batter until fully coated, then carefully lay it away from you into the hot oil. Repeat with 4 more shrimp, working in small batches so the pan is not crowded.

  6. 6

    Fry the shrimp undisturbed for 90 seconds until the bottom turns the color of light honey and no longer sticks to the bottom of the pot.

  7. 7

    Flip each shrimp with chopsticks or a fork and fry for another 60 to 90 seconds until the entire coating is the color of warm honey and looks crispy and blistered.

  8. 8

    Use a slotted spoon to lift each shrimp from the oil and place it on a plate lined with paper towels. Repeat steps 5–7 with the remaining 7 shrimp in two more batches.

  9. 9

    Serve the shrimp hot on a clean plate, drizzled lightly with salt if desired.

Tools you’ll need

  • large mixing bowl
  • whisk
  • heavy-bottomed pot or deep skillet, at least 4 quarts
  • instant-read or candy thermometer (optional but helpful)
  • wooden chopsticks or fork
  • slotted spoon
  • paper towels
  • medium plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.