CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Shrimp Fried Rice

Crispy shrimp, fluffy rice, and charred vegetables tossed in a wok-hot skillet with soy and sesame. Ready in one pan, no side dishes needed.

Total time
12 min
Servings
2
Calories
385
Protein
22g
Shrimp Fried Rice
quicksatisfyingchineseshrimpcrispytenderfluffyweeknight

Ingredients

  • ½ lb shrimp, peeled and deveined
  • 2 cups cooked white rice, cooled
  • 1 cup frozen peas and carrots blend
  • 2 tbsp soy sauce
  • 1 tsp sesame oil
  • 2 tbsp green onions, chopped

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over high heat until shimmering, about 1 minute.

  2. 2

    Add shrimp and cook without stirring for 2 minutes, then flip and cook 1 minute more until pink.

  3. 3

    Push shrimp to the side. Add peas and carrots to the pan, stir-fry for 2 minutes until hot.

  4. 4

    Add cold rice, breaking up clumps as you stir. Cook for 2 minutes, stirring constantly, until rice is hot.

  5. 5

    Drizzle soy sauce and sesame oil over the top. Toss everything together for 30 seconds until coated.

  6. 6

    Divide between bowls and top with green onions. Serve immediately.

Tools you’ll need

  • 14-inch skillet or wok
  • wooden spoon or spatula
  • measuring spoons
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.