Shoyu Ahi Poke Bowl
Sushi-grade ahi tuna marinated in a punchy shoyu-ginger sauce, served over warm rice with crispy seaweed and sesame. Ready in under 15 minutes — no cooking required for the fish.
- Total time
- 12 min
- Servings
- 2
- Calories
- 380
- Protein
- 32g
freshlighthawaiiangluten-freefishtendercrispyweeknight
Ingredients
- 3 tbsp soy sauce
- 1 tbsp sesame oil
- 1 tbsp fresh ginger, minced
- 1 tsp rice vinegar
- 10 oz sushi-grade ahi tuna, cubed
- 2 cups cooked sushi rice
- 2 sheet nori sheets, sliced into strips
- 2 tsp sesame seeds (black + white)
Instructions
- 1
Whisk soy sauce, sesame oil, ginger, and rice vinegar in a small bowl.
- 2
Add cubed ahi tuna and toss gently to coat. Let sit for 5 minutes.
- 3
Divide warm rice between two bowls. Top each with marinated ahi.
- 4
Scatter nori strips and sesame seeds over the top. Serve immediately.
Tools you’ll need
- small mixing bowl
- whisk
- two serving bowls
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
