CookSnap is coming soon — Join the waitlist →
Back to recipes

Sheet-Pan Zucchini Parm

Crispy-edged zucchini slices layered with marinara and melty mozzarella, baked until golden. A 20-minute vegetarian dinner that tastes like you spent way longer on it.

Total time
20 min
Servings
4
Calories
285
Protein
14g
Sheet-Pan Zucchini Parm
comfortitalianvegetariancheesecrispymeltytenderweeknight

Ingredients

  • 3 whole zucchini (medium, about 1.5 lbs)
  • 1.5 cups marinara sauce
  • 1.5 cups whole-milk mozzarella, shredded
  • ½ cup Parmesan, grated
  • 3 tbsp olive oil
  • 2 cloves garlic, minced

Instructions

  1. 1

    Slice zucchini lengthwise into 1/4-inch-thick planks. Pat dry with paper towels.

  2. 2

    Brush zucchini slices on both sides with olive oil. Arrange on a sheet pan in a single layer.

  3. 3

    Bake at 425°F for 8 minutes until zucchini is tender and edges start to brown.

  4. 4

    Stir garlic into marinara. Spread half the sauce over the zucchini, then layer with mozzarella and half the Parmesan.

  5. 5

    Top with remaining sauce, then remaining Parmesan. Bake 8 minutes until cheese melts and bubbles at the edges.

  6. 6

    Let cool 2 minutes, then serve hot.

Tools you’ll need

  • sheet pan
  • chef's knife
  • paper towels
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.