CookSnap is coming soon — Join the waitlist →

Sheet Pan Tandoori Chicken Wings

Crispy, spiced chicken wings roasted on a sheet pan with a yogurt-based tandoori marinade. Ready in under 30 minutes with minimal prep and maximum flavor.

Total time
28 min
Servings
4
Calories
412
Protein
38g
Sheet Pan Tandoori Chicken Wings
casualsatisfyingindiangluten-freechickencrispytenderweeknight

Ingredients

  • 1 cup Greek yogurt
  • 3 tablespoons tandoori masala spice blend
  • 3 tablespoons lemon juice
  • 3 cloves garlic, minced
  • 3 pounds chicken wings
  • 1 to taste salt and pepper

Instructions

  1. 1

    Set the oven to 450°F and wait until the indicator light tells you it has finished heating, about 10 minutes.

  2. 2

    Place the Greek yogurt, 3 tablespoons tandoori masala, 3 tablespoons lemon juice, and minced garlic into a large bowl.

  3. 3

    Stir with a wooden spoon until the mixture is smooth and uniform, with no streaks or lumps visible, about 1 minute.

  4. 4

    Pat the chicken wings dry with paper towels, removing any moisture from the surface so they will crisp better.

  5. 5

    Add the dried wings to the yogurt mixture and use your hands or tongs to coat each wing evenly, turning until no raw chicken is visible.

  6. 6

    Sprinkle salt and pepper over the coated wings and stir once more to distribute the seasoning evenly.

  7. 7

    Spread the wings in a single layer across two sheet pans, spacing them about 1 inch apart so heat circulates around each piece.

  8. 8

    Place both pans into the preheated 450°F oven and roast for 18 minutes without moving them.

  9. 9

    Remove both pans from the oven; the wings should be deep golden brown with crispy edges and no pink near the joints.

  10. 10

    Let the wings rest on the pans for 2 minutes, then slide them onto a serving plate or board.

Tools you’ll need

  • large mixing bowl
  • wooden spoon
  • paper towels
  • two 18 x 13-inch sheet pans
  • kitchen tongs or hands

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.