Sheet Pan Sausage & Vegetables
Smoked sausage, zucchini, carrots, and peppers roast together on one pan until the sausage crisps and vegetables caramelize. Ready in 25 minutes with zero cleanup.
- Total time
- 25 min
- Servings
- 4
- Calories
- 420
- Protein
- 22g
easysatisfyingitalianporkcrispytenderweeknightmain-dish
Ingredients
- 1 lb smoked sausage
- 2 medium zucchini
- 2 medium carrots
- 2 medium bell peppers
Instructions
- 1
Cut sausage into 2-inch chunks and chop zucchini, carrots, and peppers into 1-inch pieces.
- 2
Toss everything on a sheet pan with 2 tbsp oil, salt, and pepper, then spread in an even layer.
- 3
Roast at 425°F until sausage browns and vegetables soften at the edges, about 20 minutes.
- 4
Stir halfway through if the pan looks dry on one side.
- 5
Serve hot straight from the pan.
Tools you’ll need
- sheet pan
- oven
- knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
