Sheet Pan Pork Chops with Potatoes & Broccoli
Pork chops, potatoes, and broccoli roast together on one sheet pan in under 25 minutes. Everything cooks at once — no babysitting required.
- Total time
- 25 min
- Servings
- 2
- Calories
- 520
- Protein
- 42g
comfortsimpleamericanporktendercrispyweeknightmain-dish
Ingredients
- 2 chops pork chops (bone-in or boneless, about 1 inch thick)
- 12 oz potatoes (russet or Yukon gold, halved)
- 3 cups broccoli florets
Instructions
- 1
Heat oven to 425°F and line a sheet pan with foil.
- 2
Pat pork chops dry, season with salt and pepper, then place on the sheet pan.
- 3
Toss potatoes and broccoli with 2 tbsp olive oil, salt, and pepper; spread around the chops.
- 4
Roast until pork reaches 145°F internal temp and potatoes are golden, about 18–20 minutes.
- 5
Remove from oven and let rest 3 minutes before serving hot.
Tools you’ll need
- sheet pan
- aluminum foil
- meat thermometer
- tongs or spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
