Sheet Pan Philly Cheesesteak
Sliced beef, peppers, onions, and melted cheese roasted together on one sheet pan in under 20 minutes. No sandwich required—pile it on a plate and eat it hot.
- Total time
- 18 min
- Servings
- 2
- Calories
- 420
- Protein
- 38g
comfortsatisfyingamericanbeeftendermeltyweeknightmain-dish
Ingredients
- ¾ lb beef sirloin or ribeye, thinly sliced
- 2 medium bell peppers (1 red, 1 yellow), sliced into strips
- 1 large onion, sliced into thin half-moons
- 6 oz provolone or cheddar cheese, sliced or shredded
Instructions
- 1
Toss beef, peppers, and onion with 2 tbsp oil, salt, and pepper on a sheet pan until evenly coated.
- 2
Spread in a single layer and roast at 425°F for 12 minutes until beef browns and peppers soften.
- 3
Scatter cheese over the top and roast 2 more minutes until melted and bubbly.
- 4
Serve hot straight from the pan with crusty bread on the side if desired.
Tools you’ll need
- sheet pan
- oven (preheated to 425°F)
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
