CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Sheet-Pan Greek Chicken Quinoa Bowl

Roasted chicken thighs and cherry tomatoes on a bed of fluffy quinoa, finished with a lemon-herb dressing and topped with creamy feta and crispy red onion. One pan, 25 minutes, Mediterranean comfort.

Total time
25 min
Servings
2
Calories
620
Protein
48g
Sheet-Pan Greek Chicken Quinoa Bowl
freshhealthygreekmediterraneanchickencrispytenderfluffy

Ingredients

  • 1 lb boneless, skinless chicken thighs
  • 1.5 cups pre-cooked quinoa
  • 1 cup cherry tomatoes
  • ½ medium red onion
  • ¾ cup feta cheese, crumbled
  • 1 whole lemon
  • ¼ cup fresh dill
  • 4 tbsp olive oil

Instructions

  1. 1

    Pat chicken thighs dry. Toss with 2 tbsp oil, salt, pepper, and half the dill. Spread on a sheet pan alongside halved tomatoes.

  2. 2

    Roast at 425°F until chicken is golden and internal temp hits 165°F, about 15 minutes.

  3. 3

    While chicken roasts, thinly slice red onion. Toss in a bowl with a pinch of salt to soften, about 2 minutes.

  4. 4

    Whisk remaining 2 tbsp oil with lemon juice, remaining dill, salt, and pepper for dressing.

  5. 5

    Divide warm quinoa between bowls. Top with roasted chicken, tomatoes, red onion, and feta.

  6. 6

    Drizzle lemon-herb dressing over everything. Serve immediately.

Tools you’ll need

  • sheet pan
  • mixing bowl
  • small bowl
  • whisk
  • meat thermometer

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.