CookSnap is coming soon — Join the waitlist →
Back to recipes

Sheet-Pan California Pizza

Crispy-bottomed pizza loaded with roasted veggies, creamy goat cheese, and fresh arugula. Ready in 18 minutes on one sheet pan.

Total time
18 min
Servings
2
Calories
385
Protein
12g
Sheet-Pan California Pizza
casualquickcalifornianvegetariancheesecrispycreamyweeknight

Ingredients

  • 2 pieces naan or flatbread
  • 1 cup cherry tomatoes
  • 1 medium red bell pepper
  • ½ medium red onion
  • 3 oz goat cheese
  • 2 cups fresh arugula

Instructions

  1. 1

    Place naan on a sheet pan. Halve the tomatoes, slice the bell pepper into 1/4-inch strips, and thinly slice the onion.

  2. 2

    Toss tomatoes, pepper, and onion with 2 tbsp olive oil, salt, and pepper. Spread on the pan around the naan.

  3. 3

    Bake at 425°F for 10 minutes until the naan is golden and the veggies are beginning to char at the edges.

  4. 4

    Crumble goat cheese over the hot naan, then top with warm roasted veggies and their pan juices.

  5. 5

    Pile fresh arugula on top. Finish with a squeeze of lemon juice and a drizzle of olive oil.

Tools you’ll need

  • sheet pan (18×13 inch)
  • oven preheated to 425°F
  • chef's knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.