CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Sheet-Pan Burek with Spinach & Feta

Crispy phyllo-wrapped spinach, feta, and ground lamb baked until golden in under 20 minutes. A TikTok-easy Balkan classic that feels fancy but requires zero rolling skill.

Total time
18 min
Servings
4
Calories
312
Protein
11g
Sheet-Pan Burek with Spinach & Feta
elegantcomfortbalkanvegetarianeggscheesecrispycreamy

Ingredients

  • 8 sheets phyllo dough sheets
  • 4 cups fresh spinach, chopped
  • ¾ cup feta cheese, crumbled
  • 2 large eggs
  • ½ medium onion, finely diced
  • 6 tbsp olive oil
  • 1 whole lemon, zested and juiced

Instructions

  1. 1

    Heat 2 tbsp olive oil in a skillet over medium. Sauté diced onion until softened, ~3 minutes.

  2. 2

    Add spinach and cook until wilted and any liquid evaporates, ~2 minutes. Transfer to a bowl.

  3. 3

    Stir feta, eggs, lemon zest, and lemon juice into the spinach mixture. Season with salt and pepper.

  4. 4

    Brush a sheet pan with 1 tbsp olive oil. Layer 4 phyllo sheets on top, brushing each with oil.

  5. 5

    Spread spinach-feta filling evenly over phyllo. Top with remaining 4 phyllo sheets, brushing each with oil.

  6. 6

    Score the top into 8 portions with a knife. Bake at 400°F until golden brown, ~8 minutes.

Tools you’ll need

  • 12-inch skillet
  • sheet pan
  • brush (pastry or silicone)
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.