CookSnap is coming soon — Join the waitlist →

Sheet-Pan Bacalao with Tomato Sauce & Crispy Bread

Spanish salt cod sears golden and nestles into a bright, garlicky tomato sauce, finished with crusty bread for soaking. Ready in under 30 minutes and viral-ready straight from the pan.

Total time
25 min
Servings
2
Calories
385
Protein
42g
Sheet-Pan Bacalao with Tomato Sauce & Crispy Bread
comfortrusticspanishfishcrispytenderweeknightdinner

Ingredients

  • 400 g salt cod fillets (skinless, pre-soaked)
  • 400 g canned crushed tomatoes
  • 4 cloves garlic cloves (minced)
  • 1 tsp smoked paprika
  • 1 medium red bell pepper (sliced into 1/2-inch strips)
  • ½ cup green olives (pitted, halved)
  • 2 thick slices crusty bread (sliced for toasting)
  • 3 tbsp olive oil

Instructions

  1. 1

    Heat 1.5 tbsp olive oil in a large sheet pan or 12-inch skillet over medium-high heat until shimmering, about 1 minute.

  2. 2

    Pat cod dry and sear until the undersides turn golden and edges curl slightly, about 90 seconds; flip and sear 60 seconds more, then remove to a plate.

  3. 3

    Add garlic and smoked paprika to the same pan, stir for 30 seconds until fragrant (watch it doesn't burn).

  4. 4

    Pour in crushed tomatoes and add red pepper strips and olives; simmer 3 minutes until sauce thickens slightly.

  5. 5

    Nestle cod back into the tomato sauce, then brush bread slices with remaining olive oil and tuck them around the fish.

  6. 6

    Cover loosely with foil and bake at 425°F (220°C) for 5 minutes until bread is crispy and fish flakes at the thickest part.

Tools you’ll need

  • 12-inch skillet or sheet pan
  • metal spatula or fish turner
  • wooden spoon
  • foil
  • oven (or use stovetop covered with a lid)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.