CookSnap is coming soon — Join the waitlist →
Back to recipes

Sheet-Pan Apple & Potato Cake

Crispy-bottomed German apple-potato bake, golden and custardy inside. A one-pan weeknight dinner that tastes like autumn comfort food.

Total time
25 min
Servings
4
Calories
285
Protein
9g
Sheet-Pan Apple & Potato Cake
comfortwholesomegermanvegetarianeggscrispytenderfluffy

Ingredients

  • 1.5 lbs waxy potatoes (Yukon Gold or similar)
  • 3 medium tart apples (Granny Smith or Honeycrisp)
  • 4 large eggs
  • ¾ cup whole milk
  • ⅓ cup all-purpose flour
  • 1 tsp caraway seeds (optional but traditional)

Instructions

  1. 1

    Preheat oven to 425°F. Peel and thinly slice the potatoes and apples, keeping them separate.

  2. 2

    Whisk eggs, milk, flour, salt, pepper, and caraway seeds in a bowl until smooth.

  3. 3

    Oil a 9x13-inch baking sheet or cast-iron skillet. Layer half the sliced potatoes on the bottom.

  4. 4

    Layer all the apple slices over potatoes, then the remaining potatoes on top.

  5. 5

    Pour the egg mixture evenly over the stack. Drizzle the top with a thin layer of oil.

  6. 6

    Bake 18–20 minutes until the top is golden brown and a knife inserted in the center meets no resistance.

Tools you’ll need

  • 9x13-inch baking sheet or 12-inch cast-iron skillet
  • mixing bowl
  • whisk
  • vegetable peeler or mandoline
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.