CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Shanghai Chili Crisp Shrimp

Tender shrimp tossed in a glossy garlic-ginger sauce with a hit of chili crisp and a finishing splash of Shaoxing wine. One skillet, 15 minutes, pure umami.

Total time
15 min
Servings
2
Calories
245
Protein
28g
Shanghai Chili Crisp Shrimp
quicksatisfyingchineseshrimptenderjuicyweeknightmain-dish

Ingredients

  • 1 lb shrimp, peeled and deveined
  • 3 tbsp chili crisp (like Lao Gan Ma)
  • 4 cloves garlic, minced
  • 1 tbsp fresh ginger, minced
  • 2 tbsp Shaoxing wine or dry sherry
  • 3 stalks scallions, sliced thin

Instructions

  1. 1

    Pat shrimp dry with a paper towel. Season generously with salt and pepper.

  2. 2

    Heat 2 tbsp neutral oil in a 12-inch skillet over medium-high until shimmering, about 90 seconds.

  3. 3

    Add shrimp and sear without stirring for 90 seconds until the bottoms turn opaque and pink.

  4. 4

    Flip shrimp and cook 60 more seconds. Transfer to a plate.

  5. 5

    Add garlic and ginger to the same skillet. Stir constantly for 30 seconds until fragrant.

  6. 6

    Pour in Shaoxing wine, scraping up any browned bits. Return shrimp to the pan and toss with chili crisp for 60 seconds.

  7. 7

    Remove from heat. Scatter scallions over the top and serve immediately over rice or noodles.

Tools you’ll need

  • 12-inch stainless steel or cast iron skillet
  • paper towels
  • wooden spoon or silicone spatula
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.