CookSnap is coming soon — Join the waitlist →
Back to recipes

Shakshuka — Eggs in Tomato Sauce with Bread

Silky poached eggs nestle in spiced tomato sauce — the Mediterranean breakfast that feels fancy but takes 15 minutes. Serve with crusty bread for dipping.

Total time
15 min
Servings
2
Calories
285
Protein
13g
Shakshuka — Eggs in Tomato Sauce with Bread
comfortelegantmediterraneanvegetarianeggssilkytenderweeknight

Ingredients

  • 1 can (14.5 oz) canned crushed tomatoes
  • ½ medium onion, diced
  • 4 large eggs
  • ½ tsp cumin
  • 1 loaf (for serving) crusty bread
  • ¼ tsp hot sauce or chili flakes

Instructions

  1. 1

    Heat olive oil in a 10-inch skillet over medium. Add diced onion and cook until soft, ~4 minutes.

  2. 2

    Pour in tomatoes, add cumin and chili flakes, then stir. Simmer until slightly thickened, ~4 minutes.

  3. 3

    Make 4 shallow wells in the sauce. Crack an egg into each well without breaking the yolk.

  4. 4

    Cover the skillet and cook over medium until whites are set but yolks still jiggle, ~4 minutes.

  5. 5

    Remove from heat. Season with salt and pepper, then tear bread and serve alongside.

Tools you’ll need

  • 10-inch nonstick skillet with lid
  • wooden spoon
  • small bowl for cracking eggs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.