CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Shakshuka with Crispy Toast

Poached eggs in a bright, garlicky tomato sauce — the Mediterranean breakfast that doubles as dinner. Serve with crusty toast for dipping.

Total time
18 min
Servings
2
Calories
285
Protein
11g
20-Min Shakshuka with Crispy Toast
comfortsimplemediterraneanvegetarianeggssilkytenderweeknight

Ingredients

  • 2 tbsp olive oil
  • 3 cloves garlic, minced
  • 1 can (14 oz) canned crushed tomatoes
  • 4 large eggs
  • ¼ cup fresh basil, roughly torn
  • 4 slices bread, sliced

Instructions

  1. 1

    Heat oil in a 10-inch skillet over medium. Add garlic and cook 30 seconds until fragrant.

  2. 2

    Pour in tomatoes and a pinch of salt. Simmer 6 minutes, stirring occasionally, until sauce thickens slightly.

  3. 3

    Create 4 small wells in the sauce. Crack an egg into each, keeping yolks intact. Cover and cook 5–6 minutes until whites set but yolks jiggle.

  4. 4

    While eggs cook, toast bread until edges are golden and surface crisps.

  5. 5

    Scatter basil over the skillet. Serve with toasted bread alongside for dipping.

Tools you’ll need

  • 10-inch skillet with lid
  • wooden spoon or spatula
  • toaster

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.