CookSnap is coming soon — Join the waitlist →
Back to recipes

Sev Tameta

A beloved Gujarati snack of crispy sev (chickpea noodles) tossed with boiled potatoes, onions, and a tart-spicy seasoning. Sweet, salty, and tangy all at once—pure comfort food.

Total time
25 min
Servings
4
Calories
185
Protein
5g
Sev Tameta
casualwholesomeindianvegetarianvegetariancrispytendersnack

Ingredients

  • 3 whole potatoes, medium
  • 1 whole red onion, medium
  • 1 cup sev (chickpea noodles), store-bought
  • 2 tablespoons tamarind paste
  • 1 tablespoon jaggery or brown sugar
  • 1 teaspoon chaat masala
  • ¼ teaspoon cayenne pepper
  • ½ teaspoon salt
  • 2 tablespoons fresh cilantro, chopped
  • ½ whole lime

Instructions

  1. 1

    Place the 3 potatoes in a medium pot and cover them completely with cold water, about 2 inches above the potatoes.

  2. 2

    Bring the water to a boil over high heat, then reduce to medium and simmer until a knife slides through the center of the largest potato with no resistance, about 12–15 minutes.

  3. 3

    Drain the potatoes in a colander and set aside to cool until you can hold them comfortably in your hand, about 3 minutes.

  4. 4

    Once cool, peel the thin papery skin off each potato using your fingers or a small knife, working over a bowl or trash to catch the skins.

  5. 5

    Cut each peeled potato in half lengthwise from top to bottom, then lay each half flat and slice crosswise into 1/4-inch-thick slices—like slicing bread.

  6. 6

    Place the red onion root-side down on the cutting board and slice lengthwise from root to tip into 1/8-inch-thick slices, creating half-moon shapes.

  7. 7

    Pour the 2 tablespoons of tamarind paste into a small bowl and stir in the 1 tablespoon of jaggery and 2 tablespoons of water until the jaggery dissolves and the mixture looks uniform.

  8. 8

    Add the 1 teaspoon of chaat masala, 0.25 teaspoon of cayenne, and 0.5 teaspoon of salt to the tamarind mixture and stir until no lumps remain—this is your seasoning paste.

  9. 9

    Transfer the sliced potatoes and onions into a large mixing bowl and pour the seasoning paste over the top.

  10. 10

    Use a rubber spatula or large spoon to toss the potatoes and onions gently with the paste, lifting and turning the vegetables until they are coated evenly, about 1 minute.

  11. 11

    Add the 1 cup of sev to the bowl and toss everything together gently for 15–20 seconds, being careful not to crush the sev—you want it to stay crispy and whole.

  12. 12

    Transfer the mixture to a serving bowl or individual bowls and sprinkle the 2 tablespoons of fresh cilantro over the top.

  13. 13

    Squeeze the juice from the lime half over the sev tameta and serve immediately, while the sev is still crispy.

Tools you’ll need

  • medium pot
  • colander
  • cutting board
  • knife
  • small bowl
  • spoon
  • large mixing bowl
  • rubber spatula
  • serving bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.