10-Min Sesame Ginger Soba Bowl
Chilled soba noodles tossed in a punchy ginger-sesame dressing with crisp raw carrots and fresh garlic. Zero cooking except the noodles—ready in 10 minutes.
- Total time
- 10 min
- Servings
- 2
- Calories
- 385
- Protein
- 10g
freshlightjapanesevegetariandairy-freechewycrispysmooth
Ingredients
- 8 oz soba noodles
- 2 tbsp minced fresh ginger
- 2 clove garlic cloves, minced
- 3 tbsp sesame oil
- 2 tbsp soy sauce
- 2 medium carrots, julienned or thinly shredded
Instructions
- 1
Boil soba in salted water until just tender, about 4 minutes. Drain and rinse under cold water until cool.
- 2
Whisk together sesame oil, soy sauce, minced ginger, and minced garlic in a large bowl.
- 3
Add cooled noodles and shredded carrots to the dressing. Toss until every strand is coated.
- 4
Divide between bowls and serve cold or at room temperature.
Tools you’ll need
- large pot
- colander
- large mixing bowl
- whisk
- microplane or box grater
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
